Sunday, December 27, 2009

How to get High traffic and real visitors to web page or blog?

My traffic-building strategy isn’t based on tricks or techniques that will go out of style. It’s mainly about providing genuine value and letting word of mouth do the rest. Sadly, this makes me something of a contrarian today, since I happen to disagree with much of what I’ve seen written about traffic-building elsewhere. I do virtually no marketing for this site at all. My visitors do it for me, not because I trick them into doing it but simply because they want to.
Here are 10 of my best suggestions for building a high traffic web site:
1. Create valuable content.

Is your content worthy of being read by millions of people? Remember that the purpose of content is to provide value to others. Do you provide genuine value, and is it the best you’re capable of providing?
When I sit down to write, I sometimes imagine myself standing on an outdoor concert stage before an audience of a million people. Then I ask myself, “What shall I say to this audience of fellow human beings?” If a million people each spend five minutes on this site, that’s nearly 10 person-years total. I do my best to make my writing worthy of this differential. I don’t always succeed, but this is the mindset that helps me create strong content.
Think about the effect you want your writing to have on people. Since I write about personal growth, I want my writing to change people for the better. I want to expand people’s thinking, to raise their consciousness, and to help them eliminate fear from their lives. If my writing doesn’t change people’s thinking, actions, or awareness, then my value isn’t being transferred well enough.
When you focus on providing real value instead of churning out disposable content, your readers will notice. And they’ll refer others to your site — in droves. I typically see at least 10 new links to my site appearing each day (mostly via trackbacks but also via vanity feeds). I’m not going out and requesting those links — other bloggers just provide them, usually because they’re commenting on something I’ve written. Many fellow bloggers have also honored StevePavlina.com with a general recommendation for the entire site, not just links to my individual blog posts. It’s wonderful to see that kind of feedback.
Strong content is universally valued. It’s hard work to create it, but in the long run it generates lots of long-term referral traffic. I’d rather write one article I’m really proud of than 25 smaller posts. It’s been my experience that the best articles I write will outperform all the forgettable little posts I’ve made. Quality is more important than quantity. Quantity without quality, however, is easier, which is one reason so many people use that strategy. Ultimately, however, the Internet already contains more quantity than any one of us can absorb in our lifetimes, but there will always be a place for good quality content that stands out from the crowd.
If you have nothing of genuine value to offer to a large audience, then you have no need of a high-traffic web site. And if there’s no need for it, you probably won’t get it. Each time you write, focus on creating the best content you can. You’ll get better as you go along, but always do your best. I’ve written some 2000–word articles and then deleted them without posting them because I didn’t feel they were good enough.
2. Create original content.
Virtually everything on this site is my own original content. I rarely post blog entries that merely link to what others are writing. It takes more effort to produce original content, but it’s my preferred long-term strategy. I have no interest in creating a personal development portal to other sites. I want this site to be a final destination, not a middleman.
Yes, there’s a lot to read on this site, more than most people can read in a day, but there’s also a lot of value (see rule #1). Some people have told me they’ve read for many hours straight, and they leave as different people. I think anyone who reads this site for several hours straight is going to experience a shift in awareness. When you read a lot of dense, original content from a single person, it’s going to have an impact on you. And this content is written with the intention to help you grow.
Although I’m not big on competing with others, it’s hard to compete with an original content site. Anyone can start their own personal development web site, but the flavor of this site is unique simply because no one else has had the exact same experiences as me.
While I think sites that mainly post content from others have the potential to build traffic faster in the beginning, I think original content sites have an easier time keeping their traffic, which makes for a more solid, long-term foundation. Not everyone is going to like my work, but for those that do, there’s no substitute.
3. Create timeless content.

While I do occasionally write about time-bound events, the majority of my content is intended to be timeless. I’m aware that anything I write today may still be read by people even after I’m dead. People still quote Aristotle today because his ideas have timeless value, even though he’s been dead for about 2300 years. I think about how my work might influence future generations in addition to my own. What advice shall I pass on to my great grandchildren?
I tend to ignore fads and current events in my writing. Wars, natural disasters, and corrupt politicians have been with us for thousands of years. There are plenty of others who are compelled to write about those things, so I’ll leave that coverage to them.
Will the content you’re creating today still be providing real value in the year 2010? 2100? 4000?
Writing for future generations helps me cut through the fluff and stay focused on the core of my message, which is to help people grow. As long as there are people (even if our bodies are no longer strictly biological), there will be the opportunity for growth, so there’s a chance that at least some of what I’m creating today will still have relevance. And if I can write something that will be relevant to future generations, then it will certainly be relevant and meaningful today.
In terms of traffic building, timeless content connects with people at a deeper level than time-bound content. The latter is meant to be forgotten, while the former is meant to be remembered. We forget yesterday’s news, but we remember those things that have meaning to us. So I strive to write about meanings instead of happenings.
Even though we’re conditioned to believe that news and current events are important, in the grand scheme of things, most of what’s covered by the media is trivial and irrelevant. Very little of today’s news will even be remembered next week, let alone a hundred years from now. Certainly some events are important, but at least 99% of what the media covers is irrelevant fluff when viewed against the backdrop of human history.
Ignore the fluff, and focus on building something with the potential to endure. Write for your children and grandchildren.

4. Write for human beings first, computers second.

A lot has been written about the optimal strategies for strong search engine rankings in terms of posting frequency and post length. But I largely ignore that advice because I write for human beings, not computers.
I write when I have something meaningful to say, and I write as much as it takes to say it. On average I post about five times per week, but I have no set quota. I also write much longer entries than most bloggers. No one has ever accused me of being too brief. My typical blog entry is about 1500–2000 words, and some (like this one) are much longer. Many successful bloggers would recommend I write shorter entries (250–750 words) and post more frequently (20x per week), since that creates more search engine seeds for the same amount of writing. And while I agree with them that such a strategy would generate more search engine traffic, I’m not going to take their advice. To do so would interfere too much with my strategy of delivering genuine value and creating timeless content. I have no interest in cranking out small chunks of disposable content just to please a computer. Anyone can print out an article to read later if they don’t have time to read it now and if the subject is of genuine interest to them. Part of the reason I write longer articles is that even though fewer people will take the time to read them, for those that do the articles are usually much more impactful.
Because of these decisions, my search engine traffic is fairly low compared to other bloggers. Google is my #1 referrer, but it accounts for less than 1.5% of my total traffic. My traffic is extremely decentralized. The vast majority of it comes from links on thousands of other web sites and from direct requests. Ultimately, my traffic grows because people tell other people about this site, either online or offline. I’ve also done very well with social bookmarking sites like del.icio.us, digg.com, and reddit.com because they’re based on personal recommendations. I’ve probably had about a dozen articles hit the del.icio.us popular list within the past year, definitely more than my fair share.
I prefer this traffic-building strategy because it leaves me less vulnerable to shifts in technology. I figure that Google ultimately wants to make it easy for its visitors to find valuable content, so my current strategy should be in alignment with Google’s long-term strategy. My feeling is that Google would be well-served by sending more of its traffic here. But that alignment simply arises from my focus on providing value first and foremost.

5. Know why you want a high-traffic site.

I write because my purpose in life is to help people become more conscious and aware — to grow as human beings. I don’t have a separate job or career other than this. Because my work is driven by this purpose, I have a compelling reason to build a high-traffic web site, one that aligns with my deepest personal values. More web traffic means I can have a bigger impact by reaching more people. And over the course of the next few decades, this influence has the potential to create a positive change that might alter the future direction of human civilization. Most significantly, I want to help humanity move past fear and for us to stop relating to each other through the mechanisms of fear. If I fail, I fail. But I’m not giving up no matter how tough it gets.
Those are big stakes, and it might sound like I’m exaggerating, but this is the level at which I think about my work today. Everything else I do, including building a high traffic web site, is simply a means to that end. Today I’m just planting seeds, and most of them haven’t even sprouted yet. A high traffic web site is just one of the sprouts that came about as a result of pursuing the purpose that drives me. But it is not an end in itself.
What will you do if you succeed in building a high-traffic web site? If you someday find yourself in the privileged position of being able to influence millions of people, what will you say to them? Will you honor and respect this position by using it as a channel to serve the highest good of all, or will you throw that opportunity away to pursue your own fleeting fame and fortune while feeding your audience disposable drivel?
Although I launched this web site in October 2008, I’ve been writing articles since 1998, and feedback has allowed me to understand how small slices of my writing have affected certain people in the long run. After reading something I’ve written, people have quit their jobs, started their own businesses, changed religions, and ended relationships. While some people might find this level of impact ego-gratifying, for me it intensifies my feeling of personal responsibility for my writing. I’ve seen that I’m able to have an impact on people, so I damned well better make it a good one.
This “why” is what drives me. It’s what compels me to go to my computer and write something at 3am and not stop until 10am. I get inspired often. The no.1 reason I want more traffic is that it will allow me to help more people. That’s where I direct my ambition for this site, and consequently I’m extremely motivated, which certainly plays a key role in taking action.

6. Let your audience see the real you.

My life and my writing are intricately intertwined, such that it’s impossible to separate the two. When someone reads this web site, they’ll eventually come to know a great deal about me as a person. Usually this creates a skewed and inaccurate impression of who I am today because I change a lot over time — I’m not the same person I was last year — but it’s close enough. Getting to know me makes it easier for people to understand the context of what I write, which means that more value can be transferred in less time.
I’ve told many personal stories on this site, including my most painful and difficult experiences. I don’t do this to be gratuitous but rather because those stories help make a point — that no matter where you find yourself today, you always have the opportunity to grow in some small way, and no matter how small those changes are, they’re going to add up over time to create massive lifelong growth. That’s a lesson we all need to remember.
When I find ways to turn some of my darkest experiences into lessons that might help others in similar situations, it actually transforms those painful memories into joyful ones. They take on new meaning for me, and I can see that there was a positive reason I had to endure such experiences, one that ultimately serves the highest good of all. Oddly, I now find that it was my darkest times that help create the most light for others.
With respect to privacy, I don’t really care much for it. I do respect other people’s right to privacy, so when people tell me personal stories via email, I don’t turn around and re-post them to my blog. But I’m OK with being rather un-private myself. The need for privacy comes from the desire to protect the ego, which is a fear-driven desire, and fear is something I just don’t need in my life. My attitude is that it’s perfectly OK to fail or to be rejected publicly. Trying to appear perfect is nothing but a house of cards that will eventually collapse.
I think allowing people to know the real me makes it possible to build a relationship with my audience that’s based on intimacy and friendship. I dislike seeing people putting me on too much of a pedestal and using labels like “guru” or “overachiever.” Such labels create distance which makes communication harder. They emphasize our differences instead of our similarities. Communication between equals — between friends — is more effective.
More genuine communication means better connections with your audience, which means more repeat traffic and more referral traffic. This isn’t a manipulative game though, and excessive or overly dramatic self-disclosure for the purpose of linkbaiting will only backfire. Your reasons for storytelling must be to benefit your audience. The traffic benefits are a positive side effect.

7. Write what is true for you, and learn to live with the consequences.

If the stuff I’ve written on this site means I’ll never be able to run for a political office, I can live with that. I’m willing to write what is true for me, even if it goes against my social conditioning. Being honest is more important to me than being popular. But the irony is that because bold honesty is so rare among civilized humans, in the long run this may be the best traffic-building strategy of all.
People often warn me not to write things that might alienate a portion of my visitors. But somehow I keep doing the opposite and seeing traffic go up, not down. I don’t treat any subjects as taboo or sacred if they’re relevant to personal growth, and that includes diet and religion. It’s no secret that I’m a vegan ex-Catholic. Do I alienate people when I say that torturing and killing defenseless animals for food is wrong? Perhaps. But truth is truth. I happen to think it’s a bad idea to feed cows cement dust and bovine growth hormone, to pack live chickens into warehouses where the ammonia from their feces is strong enough to burn their skin off, and to feed 70% of our grain to livestock while tens of thousands of people die of hunger each day. I also think it’s a bad idea to pay people to perform these actions on my behalf. It really doesn’t matter to me that 999 people out of 1000 disagree with me. Your disagreement with me doesn’t change what went into producing your burger. It’s still a diseased, tortured, chemical-injected cow, one that was doomed to a very sad life because of a decision you made. And you’re still responsible for your role in that cow’s suffering whether you like it or not.
That last paragraph is a good example of the kind of stuff I write that makes people want to put me in a cage, inject me with hormones, and feed me cement dust. It wouldn’t surprise me terribly if that ends up being my fate.
I write what is true for me, regardless of public opinion. Sometimes I’m in the majority; sometimes I’m not. I’m fully aware that some of my opinions are unpopular, and I’m absolutely fine with that. What I’m not fine with is putting truth to a vote.
I take the time to form my own opinions instead of simply regurgitating what I was taught as a child. And I’m also well aware that there are people spending billions of dollars to make you think that a burger is not a very sad, diseased, tortured, chemical-injected cow. But I’m going to keep writing to help you remain aware of things like that, even though you may hate me for it. That defensiveness eventually leads to doubt, which leads to change and growth, so it’s perfectly fine. I’m good at dealing with defensiveness.
I don’t worry too much about hurting people’s feelings. Hurt feelings are a step in the right direction for many people. If I’m able to offend you so easily, to me that means you already recognize some truth in what I’ve written, but you aren’t ready to face it consciously yet. If you read something from me that provokes an emotional reaction, then a seed has already been planted. In other words, it’s already too late for you.
My goal isn’t to convince anyone of anything in particular. I’m not an animal rights activist, and I don’t have a religion to promote. My goal is to awaken people to living more consciously. This requires raising people’s awareness across all facets of their lives, so they can make the big decisions for themselves. It requires breaking social conditioning and replacing it with conscious awareness and intention. That’s a big job, but someone has to do it. And if I don’t do it, then I have to admit I’m just part of the problem like all the other hibernating bears.
A lot has been written about the importance of transparency in blogging, and truth is the best transparency of all. Truth creates trust, and trust builds traffic. No games, no gimmicks… just plain old brutal honesty. Even the people that say they hate you will still come back, and eventually those people will become your most ardent supporters. Even if they don’t agree with you, they’ll learn they can trust you and that your intentions are honorable, and trust is more important than agreement.

8. Treat your visitors like real human beings.

Even though I’m sitting at my computer writing this, seemingly alone, I know you’re a real human being reading it on the other end. My apologies to sentient androids who may be reading this years after it’s been written. You aren’t just a number in my web stats. Despite the technology involved and the time-space differential between my writing and your reading, there’s still a human-to-human connection between us that transcends time and space. And that connection matters to me. I feel its presence whenever I do my best writing.
While I imagine being on a stage in front of a million people when deciding which topic to write about, once I actually get going, I imagine having a one-on-one conversation with a friend. This means revealing some of myself and being honest, as the last two points already addressed, but it also means genuinely caring about you as a person. And that’s perhaps one of the best kept secrets of my success as a blogger. I actually care about helping you grow. I want you to become more conscious and aware. I want you to experience less fear in your life. And my concern for your well-being isn’t conditional upon you liking me.
I happen to think we have a lot more similarities than differences. Based on what I know about myself, I imagine you’d like your life to be better tomorrow than it was yesterday. I imagine you’d like to be happier, more fulfilled, and more at peace with yourself. I also imagine you’re living below your potential and could use some help overcoming fear and solving certain problems to enable you to tap more of that potential. And finally, I imagine you wouldn’t believe me if I said you can have it all for only $19.95 (as well you shouldn’t).
The reason I work so hard to create original content and then give it away for free is because I want to help as many people as possible. I genuinely care what happens to this beautiful planet and to the people who live here. It’s possible I actually value your life even more than you do. This is the kind of motivation that never wanes. I sometimes lose sight of it when I get caught up in the details, but the connection is always there, waiting for me to tap into it whenever I want. This provides me with a wellspring of creative ideas and an inexhaustible passion for contribution.
I don’t need to play stupid marketing and sales games with you. There’s nothing for you to buy here. Even if I add some products in the future, I’m not going to try to manipulate you into buying something you don’t need with a slew of false promises. I might make more money in the short-term by doing that, but it would sever our genuine connection, create a wall between us, and reduce the level of impact I’m able to have. Ultimately, that approach would lead to failure for me, at least in terms of how I define success. I can’t help you grow if I violate your trust.
I cannot force anyone to grow who doesn’t want to. But there are a lot of people on this planet who are now ready to let go of low-awareness living and start pushing themselves to the next level of human existence. And they need help to get there because it’s a difficult journey, and there are strong forces working against it.
Real human beings helping real human beings is ultimately what traffic growth is all about. That’s precisely what a link or a referral is. If you align yourself with the intention of genuinely helping people because you care, you’ll soon find yourself with an abundance of traffic.

9. Keep money in its proper place.

Money is important. Obviously I have bills to pay. Money pays for my computer, my high-speed internet connection, my house, and my food. I just returned yesterday from a vacation that money paid for. My Girl friend and I had a great time partly because we didn’t have to worry about money at all on the trip. We did everything we wanted to do without being hampered by a lack of funds. And this web site paid for it.
It’s important that I generate some money from my work, but it’s not necessary that I extract every possible dollar. In fact, relative to its traffic levels, I’m seriously under-monetizing this site. But money is only a means to an end, not an end in itself. Making a positive contribution to the world is a lot more important to me than money. Money can be useful in achieving this objective, but human relationships are far more important. The funny thing is that the less I rely on money, the more of it I seem to have.
I’m already making more money than I need to pay my bills, and my income from this site keeps going up each month. If I simply keep doing what I’m doing, I’ll probably end up becoming fairly wealthy. But money is an extremely weak motivator for me. Very little of what I do today has a profit motive behind it except to the extent that money will fuel more important goals. That tends to confuse certain people because some of my decisions align with earning money, but many don’t. While I do consider myself an entrepreneur (at least it’s less isolating than “guru”), I only see money as a tool for enhancing and expanding my contribution.
While many entrepreneurs pursue money for the purpose of becoming wealthy, I chose a different route. I sought to earn money for the purpose of increasing my freedom. I don’t want to get myself stuck in a pattern of working for money, so I’m constantly turning down opportunities to make money that would restrict my freedom. For example, I don’t do any consulting or coaching. Consequently, my calendar contains very few fixed appointments. This doesn’t mean I’m idle. It just means I spend my time doing what I freely choose to do instead of what others would have me do. I require this level of flexibility to do my best work.
By paying close attention to how I earn money and not just how much I earn, I keep money in its proper place. This allows me to stay focused on my purpose without getting wrapped up in less important concerns like building a brand, closing sales, or doing phony marketing.
I dislike it when other people use one-dimensional sales and marketing tactics on me, so I avoid using these techniques on this site. I’ve sort of unplugged myself from the current capitalistic system and set up a side system of my own that I find much more congruent with conscious living. I would love for other people to have the same level of freedom I enjoy each day. I’m sure I’ll continue to improve my approach over time, but it’s working wonderfully so far. Imagine having a business with no products, no inventory, no sales, and no customers, but still generating an abundant positive cashflow.
Since the income generation is largely on autopilot, I can focus my time and energy on creating content instead of on doing marketing or trying to sell something. And being able to devote so much time to content creation without worrying how I’ll pay my bills makes it a lot easier to build high traffic.
Some business models make it very challenging to build traffic. You have to spend a lot of time and energy just on lead generation, and then maybe you try to monetize those leads by selling a product or service. It’s always an uphill struggle.
I give all my best content away for free. Word of mouth does the rest. So my traffic building strategy is more like flowing downstream. It hasn’t been a struggle for me at all. And once you have sufficient traffic, it isn’t that hard to monetize it without becoming an ogre.
We’ve all heard the expression, “Build a better mousetrap, and they’ll come.” And we’ve also heard marketing and sales people say that this is just plain wrong — you have to market and sell that mousetrap effectively too. I say they’re all wrong. My approach is the equivalent of, “Build a better mousetrap and give it away for free, and they’ll come — and they’ll bring friends too.”

10. If you forget the first nine suggestions, just focus on genuinely helping people, and the rest will take care of itself.

One thing that turns me off about typical self-help marketing is that authors and speakers often position themselves as if they’re the opposite of their audience. I’m successful and you’re not. I’m rich and you’re not. I’m fit and you’re not. You need me because something is lacking in your life, I have exactly what you lack, and if you pay me (and make me even richer and you poorer), I’ll show you how you can have it too. And if it doesn’t work for you, it just means you’re even more of an idiot than the people who provided my testimonials.
I’m sure you’ve heard this sort of nonsense many times before.
All of this I’ve-arrived-and-you-haven’t stuff is stupid. It suggests that life is about destinations and that once you’ve arrived, you’re done growing and can just relax and sip fruity drinks for the rest of your life. But there’s more to life than border crossings. If you go from single to married or from non-millionaire to millionaire, that’s fine and dandy. Crossing the border into parenthood was a big one for me. But that’s only one day of my life, and to be honest, I didn’t have much control over it except for a decision made nine-months earlier (and it seemed like a pretty attractive idea at the time). What about all those other days though?
Growing as a human being is something I work on daily. I’m deeply passionate about my own growth, so naturally I want to share this part of the journey with others. If I start marketing myself with the “I’m successful and you’re not approach,” I hope someone will come put me out of my misery, since that would mean I’m done growing and ready to die. I don’t expect to ever be done growing as long as I exist as a human being. There are always new distinctions to be made and new experiences to enjoy. And yes… plenty of mistakes to be made as well.
One of the great benefits of focusing on helping others is that it gets fear out of the way. Without fear you become free to just be yourself. You’re able to take intelligent risks and remain detached from any specific outcome because the journey is more important to you than the specific stops along the way. Personally it’s not the destinations that excite me but rather the unfolding process of discovery. I love the anticipation of wondering what lies around each new bend.
If we are to help each other, we need to be partners in the pursuit of growth, not opponents. So it makes no sense to put up fake walls between us. The ego needs walls to protect it, but if we can get past the fear-based needs of the ego, we’ll make a lot more progress.
There are plenty of things I could do with this site that would make me more money or grow traffic faster in the short-term, but I won’t do them because they’ll just put more distance between us. I’ll be on my side, you’ll be on your side, and we’ll each be slightly afraid of the other. I’ll be worried that maybe you won’t buy what I’m selling, and you’ll be worried about getting ripped off or taken advantage of. We’ll just be drinking yet another round of fear, which is exactly the opposite of what we need to grow.
One of my biggest challenges in life right now is figuring out how to help enough people switch their primary polarization from fear to love. Our emotions are an energy source for us (they drive our actions), and most of the world is still driven by fear energy. Watching TV news is a good example; we can actually feel energized by watching others suffer. Hurting animals is another example; we eat their fear for breakfast. But there’s another fuel for human consciousness, and perhaps the best way to describe it is unconditional love. This isn’t the squishy emotion of romantic love — it’s a sense of connection to everything that exists and a desire to serve the highest good of all. Unconditional love, when it becomes one’s primary fuel, cultivates fearlessness. In this state you still have the biological fight-or-flight response, but you aren’t driven by emotional worries like fear of failure or fear of rejection. You feel perfectly safe regardless of external circumstances. And when you have this feeling of unconditional safety, you’re truly free to be yourself, to embrace new experiences, and to grow at a very fast pace.
Personal growth is not a zero-sum game. If you grow as a human being, it doesn’t harm me. In fact, ultimately if all of us grow as individuals, it’s going to make this whole planet better for everyone. When enough people switch their primary polarization from fear to unconditional love, this planet will become a true paradise. That’s a good thing for all of us, one that’s more important than all the money in the world.
Perhaps you have a less ambitious goal for building web traffic than raising human consciousness and working towards world peace. That doesn’t matter. You can still make helping others your primary focus, and if you do that, you’ll find it relatively easy to build a high-traffic web site. If you align yourself with serving the highest good of all, you’ll receive plenty of help along the way, and best of all, you’ll deserve it.
Do your best to help your visitors out of genuine concern for their well-being, and they’ll help you build your traffic and even generate a nice income from it. It’s as simple as that.

Promotion method for a page

If you own a website or a blog then you should know a lot about it`s promotion. Website promotion is needed to build strong traffic to your website. There are some basic principles which you should understand if you want to earn revenue from your website. First of all you should start with on page optimization. Your web page content should be rich with the keywords which are used by the internet users to find your product or services. A keyword rich website draws lot of traffic from the search engines.
There are several strategies which can be used to promote a website or a blog. Let`s discuss about them one by one. It is a good idea to start a link building campaign. It is a good idea to exchange links with reputed websites which are related to the topic of your website. You can also build an email list. An email list can bring a lot of traffic.
You should consult a professional who specializes in SEO. He can help you a lot in every sphere of link building process. There are many things which can be done by a SEO firm.
The most common methods which are being used by webmasters to promote their websites are directory submission, article submission, forum posting, blog commenting, press release submission, search engine submission, social bookmarking submission and many more. All these methods help in building links for the website. Always remember that links you are building should be of high quality. High quality links can give a lot of exposure. While building the links you should continuously monitor the traffic coming to your website. There are many tools and websites which can help you in analyzing the traffic. In this way you can know about the sources which are giving you maximum traffic.
There are many methods which can help you in building links but not all of them will be effective for your website. You should try new methods if something is not working for you.
Do you own more than one website? Do you have enough time to promote your websites? There are lots of SEO firms online which provide high quality services. You should do some research before opting a SEO firm. The firm website should be reputed and old. It is a good idea to go through the prices and services which they offer. You should plan your budget before starting a link building campaign.
It is a good idea to go through similar websites providing same services. In this way you can compare the prices. You should find lots of information related to this topic. There are many websites which offer free articles related to website promotion. It is a good idea to join a webmaster forum. A webmaster forum can help you a lot in learning new promotional techniques. You can also share tips and techniques with experienced webmasters.
Promoting something is a bit difficult process and needs lots of hard work and patience. Link building process will become bit easier for you by following some tips and techniques which I have stated above.
List out your business in google map.
I going to reveal to you the easiest way to produce highly targeted interent traffic to you and you’ll never have to pay a cent for it.

When you have used Google to find a service or product for your area have ever seen a map with several flags on it show up. That is Google Maps. What you may not know is that it is so easy to get your business or service listed on that map for your area and that the service is free…unlike the Yellowpages, etc.
Just imagine what it would be like to have hundreds of people looking for your service or product go to Google and see your business listed right there, on the first page of the search engine results. How many people do you think would get to click onto your website and thus, give you a call?
That is Google Maps for you. Instant first page rankings for your business for free.
Okay, so how do you get your business listed? Quite easy actually. It’ll only take about 10 minutes of your time.
Go to maps.google.com and then follow the directions. Easy, simple and quick. Now, I must warn you; your business will not show up right away on the map. Google says it can take up to 6 weeks, but the longest I have ever had to wait was a week.
So there you go. First page Google ranking for your business in 10 minutes and for free. Life just can’t get any better.
Nine methods to promote web
Don't make the mistake of ignoring website promotion. Every website is selling something, be it a product or a service, or maybe simply trust or a brand. This means you need visitors; the more targeted, the better. Simply creating a great site isn't enough, although it's an excellent first step. You need to be out there actively promoting it if you truly want to achieve revenue through your site.
Website promotion may very well be the most important aspect of an online business, yet it often gets overlooked. Many online businesses and websites put forth so much effort into website design, yet completely neglect the promotional aspects. This is a big mistake, and in fact I am going to give you nine methods that you can start using today to promote a website effectively.
1. Web Catalogs & Directories
Taking out annual subscriptions in one or more of the major web catalogs (e.g. Inktomi, FAST, AskJeeves, etc.) and business directories (e.g. YellowPages, Superpages) can help garner some immediate traffic for your website. Web Catalogs tend to work well for new sites, as they get you some all important links in the early stages. Business directories work for virtually any business as they put a listing (or ad) for your website right in front of people looking for exactly what you're selling.
2. Link Exchanges Programme
This is a fantastic way to increase the importance of your website in the eyes of the search engines. The rationale that the search engines use is that if other sites are linking to yours, then your site must be important. A link from another site to your site is considered a "vote" for your site. The more of these votes, the better; to an extent, of course. Steer clear of such black hat techniques as link farms and free for all (FFA) sites. I recommend starting by asking your vendors, suppliers and customers if they could link to your site in exchange for a link to theirs. You could then branch out into related businesses that service a different audience (e.g. a competitor in another city that you don't service).
3. Search Engine Submission
This step is critical for any brand new website. You'll want to let the major search engines know that your new site exists, and prompting them to visit it with a search engine submission campaign is a great start. Don't bother buying a big 1500-engine submission package ? there's only about 7 to 10 major search engines worth worrying about, and once you're listed on these, the other 1490 will pick you up (not that they'll send you any measurable traffic?). The controversy here is whether or not to continue a submission campaign. Does it help an established site? Does it hurt it? Our research indicates that it doesn't hurt. As to whether or not it helps ? for some engines yes, for others no. A big tip to give you here is to be sure to work hard to get your site listed in the important directories like DMOZ and AltaVista.
4. Electronic Newsletter
An electronic newsletter is a fantastic method for staying in touch with not only existing customers, but potential customers as well. Provide useful, interesting information on a regular basis and be sure that people can subscribe and unsubscribe easily. Utilizing a good tool (e.g. Constant Contact) will make your life easier and allow people to forward the newsletter to their friends and colleagues (known as Viral Marketing). You can also use the newsletter as a vehicle for announcements or specials. Never charge anything to subscribers, and build your list by running contests or promotions.
5. Pay-per-click
I saved this one until last as I believe it is the single most important item in this list. If you remember nothing else from this article, remember pay-per-click (or PPC). By paying for visits from people who are searching on keywords related to your product or service, you are almost ensuring that your website will generate more revenue with a higher conversion rate of visitors to customers. The more popular programs include Google AdWords, Overture Content Match and Site Match, as well as smaller players like FindWhat, Kanoodle and Mamma.
Google AdWords is a great method to get the word out about your website. This promotional technique works because it gives you the unique opportunity of targeting the type of people who visit your website. This means that your traffic is more likely to be interested in what you have to offer, hence you will make more money.
6. Press release
The first thing you need to do is get the word out about your website. This can be done instantly by incorporating press releases into your marketing campaign. Press releases are a great way to get the word out about your website in a short period of time.
7. Twitter
Twitter is a social community of people, and you can easily find people with similar interests to you. By doing this you are likely to connect with some individuals that could promote your website, and perhaps even find some customers.
8. Forums
Giving valuable information in forums can be very effective, and does not take much work on your part. Starting an interesting thread or contributing meaningful posts will get the job done.
9. Youtube
Use the power of Youtube. Youtube is a great website and by posting videos advertising your business then you can really get a lot of website traffic. Youtube is a fantastic way to promote a website effectively because of the amount of people that will potentially see your promotions.

Meta tags

Meta Title tags
The title tags should contain your most searchable keywords and must be of maximum sixty character. There should only be a title tag in a page in the format of

Keywords found in the title tags have the highest ranking value with most all of the search engines. The 60 character limit is because of varity found in the nature of search engines. some search engines will only display a maximum of sixty characters of text for a title in their search results and having your page title cut off by some search engines is not what we consifer "search engine friendly"
Meta Describtion tags
The meta describtion tags should contain a brief description of what can be found on the current page or the page which is going to be surfed by the internet surfer and must be of 150 characters of less in length.
You take your time to create a keyword rich meta description tag, which helps you increase your search engine rankings and some of the search engines will highlight search terms found in their search result helping you listing to stand out from others.But remember not all the search engines display the meta description tags everytime, but most all major search engines utilize it and display the meta description tag in their search engine result. the 150 character linit is sue to some of the search engines nature. Creating your meta descriptiom tag under 150 character helps you insure your description makes sense to those who view your page.
The format of meta description tag is
Meta keyword tags
The meta keyword tag should contain only keywords which are also found in the viewable text on the page and the maximum length of keyword should be 874 characters or less in length due to search engines nature. less keywords are more effective than more.
The meta keywords tag is not as important as it was because many searc engines no longer index words found here. The meta keyword tag can increase your search engine ranking when consatructed properly. The 874 character limit is calculated from storage ability of most of the search engines.
The format of meta keyword tag is

Brief Introduction

This is the page that I have been working from long period for the promotion of the page, site or a blog. Just creating a page is like putting the product in the godown, if the page carries no visitors. So, I have collected the tools to promote the page that is to gain the visitors for the page. The tools I have collected are in the left bar of the page written as SEO, Ad Posting, E-mail marketing and safelists. I have also created the collectio of Manual traffic exchange Programme which helps in gaining rapid traffic. I hope that they are one of the effective tools to promote the page. So, go on promoting your page and increase your daily page views of your blog, sites or page. I can ensure you that if you use those promotional programme,You will get the guranteed and valid visitors.

Thursday, December 24, 2009

Meta Tags - How to create your meta tags

Meta tags are specific HTML tags that exceed their "what you see is what you get" functions to display content and serve as a mediator between the site page and the search engines, performed by their crawling robots. The Title Tag is, as it can be assumed by its name, the site or page title that best describes the site content and purpose and contains of short phrase that can include the site name. It can be separated or not by colons but must include the words that describe the main functions of your site. When you write it, you can consider that the search engines will select your site in the search results more successfully if the metas contain the keywords you are going after in the search engine optimization. comMySite: MySite functions
Meta tags are easy to create with the PromotionWorld's Meta tag generator that makes this task an easy one step effort to get the entire code the way it should be in the site's HTML code immediately after the tag. To be sure that your meta tags contain the appropriate keywords that will lead you to the top of the search list you can try a little research using the Keyword suggestion tool. Here you can find what are the most searchable keywords related to your content and to include them in your meta tags. You can go back again and again to check and update your keyword list according to the search trends.
Search Engines - How to submit your site After your site is dressed with the meta tags, you are ready to go and submit it to the search engines. The Free Search Engine Submission tool will automatically submit your site to more than 60 search engines, including the best known. Just follow the easy steps and you will get your site submitted and a detailed report about the submission process results displayed and send to you.
Search Position - Where You Are The positions of your site is easy to find using the Keyword Ranking Monitor. This handy tool will quickly tell you the site ranking on Google. You can check the competitors' sites as well to see where you are. To find out where your competitor's sites are located you can look at the WebSite Location Tool. The effective optimization is based on statistics and you can check up how your results change thru the time using the secure help of PromotionWorld's Keyword Ranking Monitor. Your keywords and URLs are stored easily accessible with your user name and you can check the trends of any keyword search results displayed in well designed graphics. You can even select a keyword from the keyword suggestion list and import it into your keyword result table just by one click. The most advanced search at all Google Datacenters can provide you with information about how your ranking is moving depending to which server the search inquiry is sent. This Google DataCenter Watch tool can allow you to predict your keyword optimization efforts.
Links - The secret of traffic The links that are going to your site by other sites are important for your Traffic and Google PageRank. You can permanently check up your link status with this Backlink Tracker Tool. Your link history will be stored and here you can find how effective your link exchanges with other sites are - a technique of vital importance for your site online success. To check your Google PR now just go to the Google PR Tool enter the URL and get the result.
Extras - Convert your site traffic into money There is a good advertising program that gains more and more popularity and becomes a materialized developer dream of earning just from the user traffic to the site. Google AdSense is designed to provide you the opportunity to provide to your users fresh related to your content links and to make you benefit from it without any effort. Using Google AdSense Tool you can see from here how the Google Adsense ads will appear on your site. Try this simple and attractive free tool to see the Google AdSense program diversity designed for your content. If you already have a Google AdSense account you can easily monitor your AdSense data displayed in graphics and charts to get you an easy visual access to your campaign.
WebSite Gifts - Count your visitors and make them happy Your site content will be more accessible if you provide the users an option to search free thru your site pages. You can get this Free search for your site. A good gift for your site is the Free Counter displaying the number of visits for your pages. Get this tool and set it on your site. If you have an idea of some different image you can send that or if you feel, you can prepare an image and send this to be included in the tool set. Be creative and make the other users appreciate your talent. I hope that you enjoyed our touring thru the amazing tool land and you get even more ideas about how can you promote your site.


Free Classified Advertisement Sites
In 2003, the market for classified ads in the United States was $15.9 billion (newspapers), $14.1 billion (online) according to market researcher Classified Intelligence. The worldwide market for classified ads in 2003 was estimated at over $100 billion. Perhaps due to a lack of reporting solidarity Market Statistics vary concerning the total market for internet classified ads. The Kelsey Research Group lists online classified ads as being worth $13.3 billion, while Jupiter Research provides a conservative appraisal of $2.6 billion (2005) and the Interactive Advertising Bureau lists the net worth of online classified revenue at $2.1 billion (April 2006).Newspapers have continued their downward trend in classifieds revenue as internet classifieds grow. Classified advertising at some of the larger newspaper chains has dropped 14% to 20% in 2007 while traffic to classified sites has grown 23%.As the online classified advertising sector develops, there is an increasing emphasis toward specialization. Vertical markets for classifieds are developing quickly along with the general marketplace for classifieds websites. Like search engines, classified websites are often vertical in nature with sites providing advertising platforms for niche markets of buyers of sellers.
Some list of classified sites can be listed as follows, where you can submit your page, sites and blogs for free:
1second ffanet 5starads adanad 1second adtrader classified2000 metromkt theadnet adpost buysell beerinfo bestmall shoplet letskus buy-and-sell buysellcommunity cdncc carnet citynews classifieds2000 classifiedads classifiedsforfree classifiedsfree classifiedslive classifiedtoday coolcashezine cracker coolcashezine coinlink comcorner comm-plus daremore dsphere direct-go domesticsale eclassified.2n4m epage classifieds.forthefarm findit freebizadsweb freecartrader horseworldwide home.ican ads4homes fpmarketing geelong.melbourneexchange vancouver-webpages golfcircuit golf.usedtrading chinaplaza homeschoolads hooverdog heretoanywhere swap.qth hamtrader healthcaremall inetgiant interking classifieds.wwbcity intheworld iowacity vcs justmalls classifieds.livedeal lovedstuff kickads magicsearch sellswap classifieds securenet motorcyclecity music3ads musicconnection mnusa musiciansnews mytownads newquestcity nelpub netclassifieds netnickel npsglobal classifieds.nnsw ifor nettrader ozfreeonline ocala4sale citynewslive pacifichotrods pacprod place-an-ad platinumpurchase london.photo-ads quick-checks domains.googlesyndication rlaj sandiego.backpage scultura shopatthemall shopzone smbtn angelfire surplusrecord sunfleas statewidecars autotrader thegolfclassifieds tokyoyy traderonline tradenpost usedpart usfreeads vancouver-webpages beehive.twics vkool shoppersurplus domains.googlesyndication web-cat webquests webtrak webseekermall where2go peopleconnectionblog classifieds2000 edndale ourworld.compuserve tosell fy wwcd domains.googlesyndication cdepot hyt domains.googlesyndication classifieds.yahoo yummiesinc zipmall zipshop 1second.com absolutelyfreebies accusubmit.com addme adlandpro ads2go bestads business8 classifiedsclub classifiedsforfree classifiedsforfree clockwatchers comcorner ecki epage everydaybusinessonline ezfree freeclassifiedads fy holton l.webring ld linkomatic megaresponse megaresponse megaresponse nightflight qualitybooks recycler shopatthemall smallbizffa_________________________________Free Classified Ad Submitter's:ecommercedealersadsub.worldwideworkathomewavgetmyfree-classifiedshandyarchivehandyarchive

Search Engine Optimization

Search engine optimization (SEO also search optimization) is the process of editing and organizing the content on a webpage or across a website to increase its potential relevance to specific keywords on specific search engines and importantly ensuring that external links to the site are correctly titled and in abundance. This is done with the aim of achieving a higher organic search listing and thus increasing the volume of targeted traffic from search engines.SEO is one of the key Web Marketing activities and can target different kinds of searches, including image search, local search, and industry-specific vertical search engines.SEO considers how search engines work and what people search for. Optimizing a website primarily involves editing its content and HTML coding to both increase its relevance to specific keywords and to remove barriers to the indexing activities of search engines. Sometimes a site's structure (the relationships between its content) must be altered too. Because of this it is, from a client's perspective, always better to incorporate Search Engine Optimization when a website is being developed than to try and retroactively apply it.There are two basic reasons to submit a web site or web page to a search engine. The first reason would be to add an entirely new web site because the site operators would rather not wait for a search engine to discover them. The second reason is to have a web page or web site updated in the respective search engine.
Here are some links for you to promote your page, sites and blogs for free of cost:
msn
google
globalsearchdirectory
yahoo
yahoo1
global
addme
submitexpress
submitexpress1
hi5ads
websitesubmit.hypermart
freewebsubmission
etanetpromotions
website-hit-counters
linkdirectory
evrsoft
evrsoft1
uswebsites
wv-travel-directory
-web-directories
nzwebz
freedomain
bellaonline
freehitwebcounter
submit-away
roseindia
scrubtheweb
freesubmitwebsiteurl
submitshop
global
artsataltitude
forums.seochat
bblmedia
123link
lancoba
unixtools
webmasterworld
artmam
google
1second
prchecker
cheap-web-hosting-plans
best-free-web-hosting
free-hosting-hosting
free-image-hosting
free-url-redirection
biz

What is False Advertising?

Basically, false advertising is any advertising that deceives consumers. This includes misleading or deceptive advertising that technically may to true, but may be misunderstood by consumers. In most cases false advertising leads a consumer to believe that certain benefits will be received, when they're not.
The Federal Trade Commission (FTC) has the authority under Section 5 of the FTC Act to file lawsuits against advertisers believed to be making false advertising claims. This authority extends to traditional media - print, television, radio, and telephone.
The FTC's authority for false advertising has also been extended to cover online advertising, and the FTC has been very aggressive in its enforcement on the Web. Since 1994, the FTC has brought over 100 enforcement actions against online businesses.
However, claims for false advertising aren't limited to the FTC. The attorneys general of various states have also been just as active filing claims based on state laws that are similar in concept to the FTC Act.
Why It's Relatively Easy to Inadvertently Make False Advertising Claims
Most Internet entrepreneurs don't intend to make false or misleading claims.
What most Internet entrepreneurs don't know is that It's relatively easy to inadvertently make a false or misleading claim. The primary reasons are:-
-most SaaS and ecommerce websites write their own marketing copy, and
- many websites are not updated periodically.What's marketing copy?
You can boil down it down to this - it's the clever stuff you write to sell your site and it's product and/or services. And it doesn't have to be presented in the format of a typical "advertisement". It may simply be in the form of your pricing and descriptions of your products and services - and even in the text of your website legal compliance documents such as your Terms of Use.
Danger signs include incorrect product or service descriptions, incorrect pricing, or photos or online demos that don't portray your products or services accurately or completely. Maybe your descriptions, pricing, photos, and demos - and even your website legal documents -- were not misleading when they were first added to your website, but you've failed to update them over time -- with the result that now they're now out-of-date and misleading to consumers.
The 5 Rules
In interpreting the FTC Act, the FTC has determined that a representation, omission, or practice is false or misleading if it is likely to:
- mislead consumers, and
- affect consumers' behavior or decisions about a product or service.
In addition, an act or practice is false and misleading if the injury caused (or likely to be caused) is:
- substantial,
- not outweighed by other benefits, and
- not reasonably avoidable.
These rules are also reflected in various state statutes that also prohibit false advertising.
Recent Illustrative Cases
The best way to get a feel of how these rules are interpreted is to take a look at some of the cases construing them. Here's a short list of illustrative cases.
1. Earlier this month, Lifestyle Lift, a cosmetic surgery company, has reached a settlement with the State of New York over its attempts to fake positive consumer reviews on the Web. The company will pay $300,000 in penalties and costs to the state. The company had ordered employees to pretend they were satisfied customers and write glowing reviews of its face-lift procedure on websites, according to New York's attorney general. Lifestyle Lift also created its own websites of face-lift reviews to appear as independent sources.
2. In May, 2009, a trial court in Washington state ordered Expedia to pay class action plaintiffs $184,000 based on its ruling that Expedia's website Terms of Use amounted to a breach of contract. Expedia's Terms of Use stated: "service fee goes to covering costs". Plaintiffs alleged that more than costs were included in the service fees and relied on an internal Expedia email that estimated service fees would generate $2-$3,000,000 in net profit for the company in one quarter. The court stated that "plaintiffs correctly conclude that profits, not costs, are the subject matter of these 'service fees.'" Therefore, according to the court, Expedia's contractual definition of service fees that was found in its Terms of Use constituted a breach of contract because Expedia "collected profits along with covering costs."
3. In 2007, the FTC filed an action against Payneless Credit Repair, LLC and its owner for making the following claims on the company's website: "Fast, Legal, Effective, Credit Report Repair ... We will fight to remove negative items from your credit reports, so you can improve your credit score . . . " The FTC alleged that the defendants violated the FTC Act by falsely representing that they can improve consumers' credit reports by permanently removing negative information, even when the information is accurate and not obsolete.
4. In 2005, the FTC filed an action against MP3DownloadCity.com for the following ad: "And best of all people are not getting sued for using our software. yes! it is 100% legal". The FTC alleged that MP3DownloadCity.com violated the FTC Act by falsely claiming that membership in its service made P2P file sharing legal.ConclusionWriting your own website advertising copy - as well as your website legal documents - can get you in trouble if you're not careful.Sometimes you can be a little too clever. Other times, you may have simply failed to keep your product descriptions, pricing, or website documents up-to-date.For these reasons, it's a good idea to be familiar with the FTC's false advertising 5 rules and to review your website periodically to ensure that all statements are true, accurate, complete - and not misleading

click exchange of ad for high revenue

We recently announced that AdSense would start allowing Google-certified ad networks to bid for your display ad space in order to help you find new ways to generate revenue. You may have seen today's post by Neal Mohan on the Official Google Blog announcing the new DoubleClick Ad Exchange, and we'd like to take a moment to let you know how these two announcements fit together. The Google-certified ad network capability is powered by the DoubleClick Ad Exchange that we announced today. Certified ad networks are Ad Exchange participants who have gone through an additional certification process in order to be able to to bid for your ad space through AdSense. We call this feature "yield management", because it offers you the most revenue for each ad that shows on your site in real time, regardless of whether it's Google or another certified party who can offer you the highest bid. You don't need to change any of your account settings to start allowing these ads to compete. Also, you can continue to use the Ad Review Center to control which certified ad networks can appear on your site. Opening AdSense to certified Ad Exchange participants means that more advertisers will be able to bid on your ad space. We believe this will ultimately help you earn more revenue for your sites.

list of pr3 web directories
All of the directories listed below offer a one way link to your website. Just right click on any link and open in a new window, so you can submit your website information to tose directories. these are the directories with pagerank 3. It also helps you much to make your page ranked by different search engines and get high traffic or real visitors to your page.
Zopso.com
mymaldives
adspecs
reviewedweb
graydirectory
adspecs
reviewedweb
reviewedweb
cornerbooks
piggymoo
irotater
mybestdir
siteseek
urlmoz
suggestlink
freeurldirectory
free-seo-directory
softensive
linkfeads
linkaddurl
1abc
placeyourlinks
excellentweb
addlinksuggest
kit-graphik
aCotm
marketseo
addgoodsites
siteavenue
evmina
primefind
putmyfinger
telugulinks
khojbeen
mailfuture
diverselist
dramba
addlinkurl
opendir
bestsitedirectory
thats
buenoamigo
homepageseek
maxxfusion
profitchoice
websquash
optimizedirectory
smartdir
5lbs
linklair
hlnk
best-sites
directscales
sinotribe
webacclaim
rankorama
linksdirectory
surfdirections
nonar
akipus
kazancity
inter-directory
b2binternetmarketingagency
betterwebdirectory
dir365
free-advertise
link-lister
backlinkdir
web-directory
n1directory
searchsols
00link
vipabout
all-linkdirectory
bestdirectory4you

Monday, December 14, 2009

SafeLists

A safelist is a place where ALL members can SAFELY send their ads to the other members of the safelist. These emails cannot be considered as unsolicited because everyone has opted in and confirmed their email address to be placed on the safelist. It is also known as an 'optin list' or 'closed community list'. In return for you being able to send your ad to the list, the other safelist members in turn are able to send their ads to you. Safelist advertising is a great way to increase your traffic and your bottom line
! Be sure to check back often as we are always adding more safelists to our directory!

List of safelists:

http://www.highpriorityads.com/s.php?najar2008
http://safelistgirls.com/70/index.php?ref=najar2008
http://freeflow.woodoggie.com/g.cgi?r=223
http://bigdsafelists.com/break/index.php?ref=najar2008
http://safelistjunky.com/10dw/index.php?ref=najar2008 http://pizazzzhosting.com/best/index.php?ref=najar2008 http://www.jandrbiz.com/178/index.php?ref=najar2008 http://partners2enterprises.com/247/index.php?ref=najar2008
http://1perfectsafelist.safelistdepot.com/list.php
http://www.proadgroups.com/sl/14u/
http://www.123safelist.com/list.php
http://24hourstraffic.com/cgi-bin/proscript/list.cgi
http://www.proadgroups.com/sl/2_Goes_On/
http://www.partners2enterprises.com/rate/
http://1stlearnhow.evergreensafelists.com/
http://www.butterflywebworks.com/1angelcall/
http://www.proadgroups.com/sl/2_Buck_4_Ad/
http://www.bigdsafelists.com/247income/
http://www.bigdsafelists.com/247Traffic/
http://www.proadgroups.com/sl/247aday/
http://2getherness.wwsla.com/safelist/list.cgi
http://www.safelists-r.us/177/
http://www.proadgroups.com/sl/2_Your_Success/index.html
http://www.ultimatesafelisthost.com/38mandms/
http://www.elist-hosting.net/3dcashmachine/index.html
http://www.butterflywebworks.com/ThreeWay/
http://listcrazyhosting.com/ace/index.php
http://4texans.woodoggie.com/
http://www.proadgroups.com/sl/4TimesaDay/
http://www.partners2enterprises.com/5050Earnings/
http://www.proadgroups.com/sl/6FigureIncome/
http://www.proadgroups.com/sl/6s4us/
http://www.proadgroups.com/sl/7days/
http://ultimatesafelisthost.com/cyber/
http://www.timelesslists.com/boat/
http://www.bigdsafelists.com/Abate/
http://www.partners2enterprises.com/day/
http://safelistjunky.com/cp/
http://safelistjunky.com/10commandments/
http://www.listworld.biz/3/l/A_Great_Day_To_Get_Paid/index.html
http://www.bestlisthost.com/Rabbit/
http://www.bestlisthost.com/day/
http://bestadlist.com/46/
http://www.partners2enterprises.com/tale/
http://www.safelists-r.us/203/
http://bestlisthost.com/aday/
http://www.partners2enterprises.com/bostonian/
http://www.proadgroups.com/sl/A/index.html
http://www.ipostad.com/Directory/List.cgi

http://www.partners2enterprises.com/Innocence/
http://www.safelistjunky.com/slunn/
http://butterflywebworks.com/awahm/
http://a-1.hits4traffic.com/list.php
http://ultimateadgroups.com/view2/
http://www.proadgroups.com/sl/A1_Profit_Maker/index.html
http://www.proadgroups.com/sl/A1BizOpps/
http://www.proadgroups.com/sl/A24SevenAd/index.html
http://www.safelists-r.us/192/
http://www.proadgroups.com/sl/AAA_Pro_Ads/
http://www.proadgroups.com/sl/AaceSafeNetPro/
http://www.proadgroups.com/sl/AACESTAR/
http://www.proadgroups.com/sl/Aacestarbiz/
http://www.bigdsafelists.com/aamail1/
http://abbies.safelistdepot.com/list.php
http://abc.hits4traffic.com/list.php
http://abctosuccess.safelistdepot.com/list.php
http://www.proadgroups.com/sl/ABC_Group/
http://www.proadgroups.com/sl/Abercorn/
http://www.safelist-hosting.us/abtech/
http://www.partners2enterprises.com/adorable/
http://www.partners2enterprises.com/AbundantTreasures/
http://www.listworld.biz/safelists/lists/access/
http://www.proadgroups.com/sl/Access_One/index.html
http://www.proadgroups.com/sl/Accumail_2/
http://www.safelistgirls.com/2/index.php
http://ultimateadgroups.com/go/
http://www.bigdsafelists.com/aos/
http://www.proadgroups.com/sl/AdMan/
http://www.safelistgirls.com/coffee/index.php
http://www.proadgroups.com/sl/Ace_Promotions/
http://ultimatesafelisthost.com/bigdreams/
http://sdtadvertising.com/nitroblogger/index.php
http://acornsandoaks.evergreensafelists.com/list.php
http://www.safelist-hosting.us/actingsmart/
http://www.proadgroups.com/sl/ActionAdz/
http://www.partners2enterprises.com/more/
http://www.partners2enterprises.com/assets/
http://www.partners2enterprises.com/assist/
http://www.partners2enterprises.com/assistance/
http://sl.safelisthosters.com/list.php
http://www.tydeuss.com/AB/index.php
http://www.tydeuss.com/AC/
http://safelistjunky.com/craze/
http://www.bestlisthost.com/FFAMagic/
http://www.proadgroups.com/sl/Ad_Masters/index.html
http://www.tydeuss.com/AM/

Top 25 Tips for marketting blogs

With so many blogs being created every day, it’s a mystery to many bloggers how to make their blog stand out. There are many types of blogs or purposes for blogs and a certain number of tactics are applicable to just about all of them, so here is a “short” list of tips for marketing and optimizing a blog:

1. Decide on a stand alone domain name www.myblog.com or directory of existing site www.mysite.com/blog. Sub domain is also an option blog.mysite.com. Avoid hosted services that do not allow you to use your own domain name!

2. Obtain and install customizable blog software - WordPress and Moveable Type are my favorites.

3. Customize blog look and feel templates - aka design.

4. Research keywords and develop a glossary - Keyword Discovery, WordTracker, SitePoint, SEOBook Keyword Research.

.5. Optimize the blog:
Template optimization - RSS subscription options, social bookmark links, HTML code, Unique title tags, URLs, Sitemap
Add helper plugins specific to WordPress or MT
Create keyword rich categories (reference your keyword glossary)

6. Enable automatic trackback and ping functionality.

7. Create Feedburner Pro account and enable feed tracking.

8. Setup Google acount for Sitemap, validate and prep for future submission.

9. Identify authoritative blogs, web sites and hubs for outbound resource links and blogroll.

10. Format archived posts, related posts.

11. Enable statistics for tracking - Performancing, Google Analytics, ClickTracks.

12. Submit RSS feed and Blog URL to prominent RSS and Blog directories / search engines.

13. Engage in an ongoing link building campaign.

14. If podcast or video content are available, submit to Podcast and Vlog directories.

15. Submit blog url to paid directories with categories for blogs - Yahoo, BOTW, bCentral, WOW, JoeAnt.

16. Optimize and distribute a press release announcing blog.

17. Request feedback or reviews of your blog in relevant forums, discussion threads. If you have a resourceful post that will help others, point to it.

18. Research and comment on relevant industry related blogs and blogs with significant centers of influence.

19. Post regularly. If it’s a news oriented blog, 3-5 times per day. If it’s an authoritative blog, 3-5 times per week, but each post must be unique and high value.

20. Monitor inbound links, traffic, comments and mentions of your blog - Google Alerts, Technorati, Blogpulse, Yahoo News, Ask Blogs and Feeds.

21. Always respond to comments on your blog and when you detect a mention of your blog on another blog, thank that blogger in the comments of the post.

22. Make contact with related bloggers on AND offline if possible.

23. When making blog posts always cite the source with a link and don’t be afraid to mention popular bloggers by name. Use keywords in the blog post title, in the body of the post and use anchor text when you link to previous posts you’ve made.

24. Use social networking services, forums and discussion threads to connect with other bloggers. If they like your stuff, they will link to you.

25. Remember when web sites were a new concept and the sage advice to print your web address everywhere you print your phone number? The same advice applies for your blog.

Of course if you don’t want to do it yourself, you can always have a blog consultant do these things (and more) for you, but I realize that there are quite a few personal bloggers as well as small business bloggers looking for this kind of information. I hope it’s helpful.

Our Circle

Increase you revenue in PPC
This is the group created under najar2008, which helps all the affilate to increase there revenue through different means and medians. Hope you all will love to work under this circle. It is not the vast task. It is one of the simple way to promote your page and generate money through different affilates programmes related to PPC that is payment per click.

Procedure to work:
1) You need to submit your web page to najar2008@yahoo.com2) After You send the page, your page will be added to http://link2xchange.blogspot.com/3) After your page is added you, just need to view all the pages of important links with proof in every 7 days.(that is you need to send the link of latest posting to oldcosmic@yahoo.com)4) Second duty for you is that you need to click on the ads (related to PPC) with proof in every 14 days.( that is you need to send the link of that ads to oldcosmic@yahoo.com)

Terms and conditoins:-
If you won't perform your task for 1 week then your link will be automatically deleted from the list and you should start the procedure from the beginning.

Important Links